DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and rx2

DIOPT Version :10

Sequence 1:NP_573242.2 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_571301.2 Gene:rx2 / 30473 ZFINID:ZDB-GENE-990415-237 Length:327 Species:Danio rerio


Alignment Length:111 Identity:50/111 - (45%)
Similarity:68/111 - (61%) Gaps:1/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 GPPSEGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDL 282
            |.|......|...|...|:|....|.||:||.|.::||.||||||..|||||::.||.|||:::|
Zfish   110 GDPRSNVESDSRSPDIPDEDQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNL 174

  Fly   283 KESRVAVWFQNRRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIPPN 328
            .|.||.|||||||||.|::|....|..: .|::..::.:..|:.||
Zfish   175 PEVRVQVWFQNRRAKWRRQEKMDTGTMK-LHDSPIRSFNRPPMAPN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_573242.2 Homeodomain 244..300 CDD:459649 36/55 (65%)
rx2NP_571301.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..139 9/28 (32%)
Homeodomain 136..192 CDD:459649 36/55 (65%)
OAR 302..316 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Nuclear localization signal. /evidence=ECO:0000255 310..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.