DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and Prrx1

DIOPT Version :10

Sequence 1:NP_573242.2 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_722543.1 Gene:Prrx1 / 266813 RGDID:628884 Length:245 Species:Rattus norvegicus


Alignment Length:74 Identity:41/74 - (55%)
Similarity:52/74 - (70%) Gaps:4/74 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 DGD----DDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQN 293
            |.|    ::....|:||:||.|||.||:.|||.|..:||||.|:||.||.|::|.|:||.|||||
  Rat    80 DNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQN 144

  Fly   294 RRAKVRKRE 302
            ||||.|:.|
  Rat   145 RRAKFRRNE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_573242.2 Homeodomain 244..300 CDD:459649 36/55 (65%)
Prrx1NP_722543.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..103 8/22 (36%)
Homeodomain 99..151 CDD:459649 33/51 (65%)
OAR 219..235 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 222..235
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.