DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and Uncx

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_038730.1 Gene:Uncx / 22255 MGIID:108013 Length:530 Species:Mus musculus


Alignment Length:391 Identity:142/391 - (36%)
Similarity:173/391 - (44%) Gaps:96/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PFLQFGVPGVFGPNGPFLGRP----RFDAASAGGHPNSAAAAAAATQMAAVNASNAFANLTGLSA 178
            |..|||     |..|..:|.|    ........||...:||||||.      ||..| ::.||.:
Mouse    10 PHAQFG-----GSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAA------ASVPF-SIDGLLS 62

  Fly   179 AALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPPAGPPSEGSNE-----DGGFPGDGDDDS 238
            .          :..||.||.|          |...|.||.....|.::     |.   ||.|.:|
Mouse    63 G----------SCAAAAASVV----------NPTPLLPAACGVAGESQPFKLADS---GDPDKES 104

  Fly   239 SAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREH 303
            ...||||:||||..|||||||:||:.|||||:|||||||:||||.||||.|||||||||.||:|:
Mouse   105 PGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKEN 169

  Fly   304 TKKGPGRPAHNAQPQTCSGEPIPPNELKAKE----RARRRKKLAKAIDRQARKLQAKGITVDLEA 364
            |||||||||||:.|.||||||:.|.|:..||    ..::||...|.:..|:|.|.:.|       
Mouse   170 TKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQSRHLHSPG------- 227

  Fly   365 LKAEYISQHKANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGGGGGGGTGGGG-- 427
                .:|.|.|..:.|||            ||.....|............|.|..|.|..|..  
Mouse   228 ----GLSLHSAPSSDSDS------------GGGGLSPEPPEPPPPTAAAKGPGAHGSGIAGSAPV 276

  Fly   428 -------------------GGGASSSLHCGLDGDGDSSRAGSFIGGGGSLGSP--SSVAPPSMLS 471
                               ..||.|....|...|.|:...|.  |...:.|.|  |..:..|:||
Mouse   277 PPGEPPAPGTCDPAFYPSQRSGAGSQPRLGRPADKDTVPCGP--GAAATAGLPKASPFSVESLLS 339

  Fly   472 N 472
            :
Mouse   340 D 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 42/52 (81%)
NK <327..>368 CDD:302627 11/44 (25%)
UncxNP_038730.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111 7/23 (30%)
Homeobox 112..165 CDD:278475 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..360 60/201 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7100
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - otm43154
orthoMCL 1 0.900 - - OOG6_108739
Panther 1 1.100 - - LDO PTHR46799
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.