DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and Alx1

DIOPT Version :10

Sequence 1:NP_573242.2 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001408403.1 Gene:Alx1 / 216285 MGIID:104621 Length:377 Species:Mus musculus


Alignment Length:93 Identity:47/93 - (50%)
Similarity:63/93 - (67%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NRQSLPPAGPPSEGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMRE 274
            |.:..|..|.|.:...::.|  ...|.:.|::|:||.||.|.|.||||||:.|..:||||:::||
Mouse   101 NLRMSPVKGMPEKSELDELG--DKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVRE 163

  Fly   275 ALAMRLDLKESRVAVWFQNRRAKVRKRE 302
            .||:|.:|.|:||.|||||||||.||||
Mouse   164 QLALRTELTEARVQVWFQNRRAKWRKRE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_573242.2 Homeodomain 244..300 CDD:459649 35/55 (64%)
Alx1NP_001408403.1 Homeodomain 133..189 CDD:459649 35/55 (64%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 47/93 (51%)
OAR 302..320 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.