Sequence 1: | NP_001285389.1 | Gene: | unc-4 / 32757 | FlyBaseID: | FBgn0024184 | Length: | 588 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099209.1 | Gene: | Prrx2 / 113931 | RGDID: | 1311471 | Length: | 248 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 74/205 - (36%) |
---|---|---|---|
Similarity: | 94/205 - (45%) | Gaps: | 38/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 AAAAAAATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPP 216
Fly 217 AGP---------PSEGSN------EDG--GFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSA 264
Fly 265 SHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTK---------KGPGRPAHNAQPQTC 320
Fly 321 SGEPIPPNEL 330 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unc-4 | NP_001285389.1 | Homeobox | 246..299 | CDD:278475 | 34/52 (65%) |
NK | <327..>368 | CDD:302627 | 2/4 (50%) | ||
Prrx2 | NP_001099209.1 | Homeobox | 104..156 | CDD:395001 | 33/51 (65%) |
COG5576 | <110..214 | CDD:227863 | 38/86 (44%) | ||
OAR | 222..238 | CDD:397759 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |