DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and Prrx2

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001099209.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:205 Identity:74/205 - (36%)
Similarity:94/205 - (45%) Gaps:38/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 AAAAAAATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPP 216
            :||||.|....|.......|  .|..|.|.:|.|.:....:..||:.          |.|.:.|.
  Rat     3 SAAAAFALDPPAPGPGPPPA--PGDCAQARKNFSVSHLLDLEEVAAA----------GRRAAGPV 55

  Fly   217 AGP---------PSEGSN------EDG--GFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSA 264
            .||         ||.||:      :||  ..||.|.......|:||:||.|||.||:.|||.|..
  Rat    56 PGPEAREGAAREPSGGSSGSEAAPQDGECAAPGHGSATKRKKKQRRNRTTFNSSQLQALERVFER 120

  Fly   265 SHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTK---------KGPGRPAHNAQPQTC 320
            :||||.|:||.||.|::|.|:||.|||||||||.|:.|...         |..|:.|...||...
  Rat   121 THYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAP 185

  Fly   321 SGEPIPPNEL 330
            ....:.|:.|
  Rat   186 RPTTLSPDYL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 34/52 (65%)
NK <327..>368 CDD:302627 2/4 (50%)
Prrx2NP_001099209.1 Homeobox 104..156 CDD:395001 33/51 (65%)
COG5576 <110..214 CDD:227863 38/86 (44%)
OAR 222..238 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.