DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and Drgx

DIOPT Version :10

Sequence 1:NP_573242.2 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Drgx / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:103 Identity:31/103 - (30%)
Similarity:43/103 - (41%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 PSEEFELTVDN-----NGSAAQNLQI-NVPSTTTTAKPSKRQRTEPTAVWDRHGYENRMATNDDG 719
            |..|.||:||:     ....:|..|. ..|||...||..:....|...|  |:|.|:  |:..:|
Mouse   694 PKAEEELSVDSVLEPEQEKMSQGFQFERDPSTLKRAKAEEENGEEAEPV--RNGAES--ASEGEG 754

  Fly   720 EYQWSGANQQQNN--THPY---SWNTNDAWGDRTIYDR 752
            ....||:.....:  |.|:   ||...|..|.:. |||
Mouse   755 GDANSGSTDSSGDGVTFPFKAESWKPADTEGKKQ-YDR 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_573242.2 Homeodomain 244..300 CDD:459649
DrgxXP_006518472.1 Homeodomain 125..181 CDD:459649
OAR 292..309 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.