DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and alx4a

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_001340966.1 Gene:alx4a / 100006399 ZFINID:ZDB-GENE-070712-3 Length:368 Species:Danio rerio


Alignment Length:98 Identity:48/98 - (48%)
Similarity:66/98 - (67%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 MIGNRQSLPPAG--PPSEGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPD 269
            |.|:..|:..:|  .|.:.::|........:.:|:..|:||:||.|.|:||||||:.|..:||||
Zfish   137 MDGSYLSVKDSGVKSPQQATSELASPLDKTEGESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPD 201

  Fly   270 IFMREALAMRLDLKESRVAVWFQNRRAKVRKRE 302
            ::.||.||:|.||.|:||.|||||||||.||||
Zfish   202 VYAREQLALRTDLTEARVQVWFQNRRAKWRKRE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 34/52 (65%)
NK <327..>368 CDD:302627
alx4aXP_001340966.1 Homeobox 179..231 CDD:278475 34/51 (67%)
OAR 344..361 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.