DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment raskol and RASAL1

DIOPT Version :9

Sequence 1:NP_001285388.1 Gene:raskol / 32754 FlyBaseID:FBgn0261570 Length:2016 Species:Drosophila melanogaster
Sequence 2:NP_001180449.1 Gene:RASAL1 / 8437 HGNCID:9873 Length:806 Species:Homo sapiens


Alignment Length:641 Identity:162/641 - (25%)
Similarity:267/641 - (41%) Gaps:113/641 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 HQSVLGRRHCFQ--VRGGPRGERYYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKM----- 735
            |..::|:....:  :...|||           .|.||...|  :.|:||.......|::|     
Human    80 HDDIIGKISLSREAITADPRG-----------IDSWINLSR--VDPDAEVQGEICLSVQMLEDGQ 131

  Fly   736 ------WVYEAKNLPPKKRYFCELQLDKTLYG----RTSVKLQTDLLFWGEHFDFPDIPEI-NVI 789
                  .|.:|::|.|:..........:..:|    .||...:|....|.|..:..::|.. :.:
Human   132 GRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHWDEVLELREMPGAPSPL 196

  Fly   790 TVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWYPILSDKAGDSLGRTSGGGGSGSKDK 854
            .|.:: :.|...|.|   |:|.|:.....:..: |.:.|:.:|.....:   ..|||        
Human   197 RVELW-DWDMVGKND---FLGMVEFSPKTLQQK-PPKGWFRLLPFPRAE---EDSGG-------- 245

  Fly   855 EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCE--TLEPVIGVK------AKEDIGQAL 911
             .|..||:|.|.....:||...|...:..|.|:.:...|  |..|:..::      .::|:...|
Human   246 -NLGALRVKVRLIEDRVLPSQCYQPLMELLMESVQGPAEEDTASPLALLEELTLGDCRQDLATKL 309

  Fly   912 VLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINEL 976
            |.|...:||||.||..:...::.|..|....||.||||:||||.|:||.|..||.:.|...|:.:
Human   310 VKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLASKSMEQFMKLVGMPYLHEVLKPVISRV 374

  Fly   977 IQSERDCEVDPTKTS-G-----SSAGSLQRQQ------AALRGAVRGAWQCIFESHKHFPAQLRN 1029
            .:.::..|:||.|.. |     |..|:|..:|      ..|.|.:......|..|....|..:|.
Human   375 FEEKKYMELDPCKMDLGRTRRISFKGALSEEQMRETSLGLLTGYLGPIVDAIVGSVGRCPPAMRL 439

  Fly  1030 CFATFRERLQQL-----GRQDMADNLISASIFLRFLCPAILSPSLFNITSELPSARATRNLTLVA 1089
            .|.....|:::.     .:||:....||..:||||..||||:|.||::..:....:.:|:|.|:|
Human   440 AFKQLHRRVEERFPQAEHQQDVKYLAISGFLFLRFFAPAILTPKLFDLRDQHADPQTSRSLLLLA 504

  Fly  1090 KTLQTLANFTR--FQGKENFMEFLNDFLEQEAARMQQFLE-IISTRPEHPA--------PDSILD 1143
            |.:|::.|..:  .||||.:|..|:.||.|..:|::.||: ::....:..|        |.|.:.
Human   505 KAVQSIGNLGQQLGQGKELWMAPLHPFLLQCVSRVRDFLDRLVDVDGDEEAGVPARALFPPSAIV 569

  Fly  1144 WAGYIDQGKQ----LSILHS-------LLSESL--AKLPEARQHELDPLQHI-----LDEISRAK 1190
            ..||:.:.|:    |:...:       |..|:|  :|.||.:.....|:.||     :||.:...
Human   570 REGYLLKRKEEPAGLATRFAFKKRYVWLSGETLSFSKSPEWQMCHSIPVSHIRAVERVDEGAFQL 634

  Fly  1191 EHGMGTALPGGYLPATSSTHS--IASENQENRNPGSSGSHAGSNSEQLLPQQSQLA 1244
            .|.|......|    |.:.|:  :..:|....|...|.....|     .|..::||
Human   635 PHVMQVVTQDG----TGALHTTYLQCKNVNELNQWLSALRKAS-----APNPNKLA 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
raskolNP_001285388.1 PH_RasSynGAP-like 615..729 CDD:270082 12/52 (23%)
PH <656..720 CDD:278594 9/43 (21%)
C2_SynGAP_like 721..874 CDD:175980 35/168 (21%)
RasGAP 856..1185 CDD:214617 110/382 (29%)
RasGAP_DAB2IP 865..1192 CDD:213338 108/380 (28%)
RASAL1NP_001180449.1 C2 6..126 CDD:301316 13/58 (22%)
C2 134..255 CDD:301316 28/137 (20%)
RasGAP 243..606 CDD:214617 107/371 (29%)
RasGAP_RASAL 263..550 CDD:213337 88/286 (31%)
PH-like 554..691 CDD:302622 30/137 (22%)
PH 568..674 CDD:278594 24/114 (21%)
BTK 683..710 CDD:279161
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2053
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.