DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment raskol and Nf1

DIOPT Version :9

Sequence 1:NP_001285388.1 Gene:raskol / 32754 FlyBaseID:FBgn0261570 Length:2016 Species:Drosophila melanogaster
Sequence 2:NP_733132.2 Gene:Nf1 / 43149 FlyBaseID:FBgn0015269 Length:2802 Species:Drosophila melanogaster


Alignment Length:436 Identity:116/436 - (26%)
Similarity:179/436 - (41%) Gaps:66/436 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 LGRTSGGGGSGSKDKEQLPTLRIKCRFQS--TDILPINVYGNFL--TYLKENYKRVCE------- 893
            ||.....|...|.|....|.|:.:..|..  |.||......:.|  |.|.:.::::.:       
  Fly  1197 LGANIDSGLMHSIDLGYNPDLQTRAAFMEVLTQILQQGTEFDTLAETVLADRFEQLVQLVTMISD 1261

  Fly   894 --------TLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGD-QRLTFRGNSLA 949
                    .|..|:.....:::.:.||.|..|:.|....|.::...: :.|.| .:..||||||.
  Fly  1262 KGELPIAMALANVVTTSQMDELARVLVTLFDAKHLLSPLLWNMFYRE-VEVSDCMQTLFRGNSLG 1325

  Fly   950 TKSMEAFLKLTGEQYLQDTLSAPINELIQSERD-C-EVDPTKTSGSSAGSLQRQQAALRGAVRGA 1012
            :|.|....|:.|..|||..|...|..|:..|.: | ||||.:...:.  .:::.:..|....:..
  Fly  1326 SKIMAFCFKIYGASYLQMLLEPLIRPLLDEEEETCFEVDPARLDPTE--DIEQHRNNLIALTQKV 1388

  Fly  1013 WQCIFESHKHFPAQLRN-CFATFR---ERLQQLGRQDMADNL--ISASIFLRFLCPAILSPSLFN 1071
            :..|..|...||.|||: |...::   :|...|    :.:|:  :...|||||:.|||:||....
  Fly  1389 FDAIINSSDRFPPQLRSMCHCLYQVLSKRFPNL----LQNNIGAVGTVIFLRFINPAIVSPQELG 1449

  Fly  1072 ITSELPSARATRNLTLVAKTLQTLANFTRFQGKENFMEFLNDFLEQ--EAARMQQFLEIISTRPE 1134
            |..:...:.|.|.|.|::|.||.:||...| .||..|...||||..  ||.| :.|::|.|   :
  Fly  1450 IVDKQVHSSAKRGLMLMSKILQNIANHVEF-SKEQHMLCFNDFLRDHFEAGR-RFFIQIAS---D 1509

  Fly  1135 HPAPDSILDWAGYIDQGKQLSILHSLLSESLAK----LPEARQHELDPLQHILDEISRAKEHGMG 1195
            ....|.......:|.....|: ||.||.....|    |..:|.|:         .:.|.....|.
  Fly  1510 CETVDQTSHSMSFISDANVLA-LHRLLWTHQEKIGDYLSSSRDHK---------AVGRRPFDKMA 1564

  Fly  1196 TAL----PGGYLPATSSTHSIASENQENRNPGSSGSHAGSNSEQLL 1237
            |.|    |..:.|..|  |.:.|....    .||...:.:|.|:::
  Fly  1565 TLLAYLGPPEHKPVDS--HMMFSSYAR----WSSIDMSSTNFEEIM 1604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
raskolNP_001285388.1 PH_RasSynGAP-like 615..729 CDD:270082
PH <656..720 CDD:278594
C2_SynGAP_like 721..874 CDD:175980 11/35 (31%)
RasGAP 856..1185 CDD:214617 98/362 (27%)
RasGAP_DAB2IP 865..1192 CDD:213338 97/360 (27%)
Nf1NP_733132.2 RasGAP_Neurofibromin 1242..1575 CDD:213332 96/354 (27%)
CRAL_TRIO_2 1633..1767 CDD:404584
PH_NF1 1759..1868 CDD:270123
MOR2-PAG1_mid <1931..>2109 CDD:372971
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10194
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.