DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment raskol and Rasal3

DIOPT Version :10

Sequence 1:NP_001285388.1 Gene:raskol / 32754 FlyBaseID:FBgn0261570 Length:2016 Species:Drosophila melanogaster
Sequence 2:XP_006524475.1 Gene:Rasal3 / 320484 MGIID:2444128 Length:1065 Species:Mus musculus


Alignment Length:137 Identity:34/137 - (24%)
Similarity:46/137 - (33%) Gaps:52/137 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VGTAPEGIRAEVIA--------VESFEEFENFTADQVEGK-----------------------IV 171
            ||...||.|.:..|        .||..|.|:.::....||                       :|
Mouse   199 VGVDTEGSRVDRAASRSSSPSPPESLAEEEHPSSRDSNGKQQRAEDKNMSGPYDSEEDKSDYNLV 263

  Fly   172 VF--------APAWVGYG------PTGRYRYDSP-SVAAKKGAAAVLIRS----MTPFSIGTPHT 217
            |.        :||....|      |..|...||| |:|:..|:.  |.||    :...|.|||.:
Mouse   264 VDEDQPSEPPSPATTPCGKAPLCIPARRDLTDSPASLASSLGSP--LPRSKDLALNDLSTGTPAS 326

  Fly   218 GTLAYDP 224
            |:....|
Mouse   327 GSCGPSP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
raskolNP_001285388.1 PH_RasSynGAP-like 615..729 CDD:270082
C2_SynGAP_like 721..874 CDD:175980
RasGAP_DAB2IP 865..1192 CDD:213338
DUF3498 <1927..1997 CDD:463427
Rasal3XP_006524475.1 PH-like 227..372 CDD:473070 25/109 (23%)
C2 346..478 CDD:472691
RasGAP_DAB2IP 470..793 CDD:213338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.