powered by:
Protein Alignment raskol and si:dkeyp-72a4.1
DIOPT Version :9
Sequence 1: | NP_001285388.1 |
Gene: | raskol / 32754 |
FlyBaseID: | FBgn0261570 |
Length: | 2016 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001121846.1 |
Gene: | si:dkeyp-72a4.1 / 100148058 |
ZFINID: | ZDB-GENE-070705-551 |
Length: | 222 |
Species: | Danio rerio |
Alignment Length: | 55 |
Identity: | 16/55 - (29%) |
Similarity: | 22/55 - (40%) |
Gaps: | 12/55 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 620 SKKSNPLKRTKSV------------TKLERTKRGSGGLRGSRSHESLLSSHAVMS 662
|.||..|:||.|| ..::..:|.||...|.|..|..|....|::
Zfish 81 SSKSRLLRRTISVPVETHFPGFQSHLSVDNNERASGAGEGRREDEGFLQFFTVIN 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170577562 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.