DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment raskol and si:dkeyp-72a4.1

DIOPT Version :9

Sequence 1:NP_001285388.1 Gene:raskol / 32754 FlyBaseID:FBgn0261570 Length:2016 Species:Drosophila melanogaster
Sequence 2:NP_001121846.1 Gene:si:dkeyp-72a4.1 / 100148058 ZFINID:ZDB-GENE-070705-551 Length:222 Species:Danio rerio


Alignment Length:55 Identity:16/55 - (29%)
Similarity:22/55 - (40%) Gaps:12/55 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 SKKSNPLKRTKSV------------TKLERTKRGSGGLRGSRSHESLLSSHAVMS 662
            |.||..|:||.||            ..::..:|.||...|.|..|..|....|::
Zfish    81 SSKSRLLRRTISVPVETHFPGFQSHLSVDNNERASGAGEGRREDEGFLQFFTVIN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
raskolNP_001285388.1 PH_RasSynGAP-like 615..729 CDD:270082 16/55 (29%)
PH <656..720 CDD:278594 1/7 (14%)
C2_SynGAP_like 721..874 CDD:175980
RasGAP 856..1185 CDD:214617
RasGAP_DAB2IP 865..1192 CDD:213338
si:dkeyp-72a4.1NP_001121846.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.