DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and RIPK1

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001341859.1 Gene:RIPK1 / 8737 HGNCID:10019 Length:671 Species:Homo sapiens


Alignment Length:291 Identity:70/291 - (24%)
Similarity:136/291 - (46%) Gaps:48/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TQNMRVKKDTLF--------NERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLG 120
            ||.:.:.| |::        ||.::.||.::.:|:|..:|...|||. :||..:|.:|.  ...|
Human    38 TQGLMIMK-TVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVII-EEGKYSLVMEY--MEKG 98

  Fly   121 SILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVKGEFEICKLCDFGV 185
            :::.....|...||..|.  ::|:::.:.:.:||.:. ::|.|||..|:||..:|.| |:.|.|:
Human    99 NLMHVLKAEMSTPLSVKG--RIILEIIEGMCYLHGKG-VIHKDLKPENILVDNDFHI-KIADLGL 159

  Fly   186 S-------LPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDS-KADIFSFGLVIYETLAL 242
            :       |..:|..|:..:.....:..||..:.|||.:::|:...: |:|::||.:|::...|.
Human   160 ASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFAN 224

  Fly   243 VPPHTLELDAALGEDM--------------DSSHDLPTDTDKLQ--CKQLDFSSDENKNGLPSAM 291
            ..|:    :.|:.|..              |.:...|.:...|.  |.:   ::.|.:...|...
Human   225 KEPY----ENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWE---ANPEARPTFPGIE 282

  Fly   292 EEHTDNDMSQDYDEEDDEEEKEEEEEDDEED 322
            |:.....:|| .:|..:|:.|..::|...|:
Human   283 EKFRPFYLSQ-LEESVEEDVKSLKKEYSNEN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 70/291 (24%)
S_TKc 30..>245 CDD:214567 53/196 (27%)
RIPK1NP_001341859.1 STKc_RIP1 23..290 CDD:270929 63/266 (24%)
Interaction with SQSTM1. /evidence=ECO:0000269|PubMed:10356400 290..582 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..354
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..458
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:11734559, ECO:0000269|PubMed:29681455 531..547
Death_RIP1 583..668 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.