DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and tnni3k

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001191752.1 Gene:tnni3k / 799621 ZFINID:ZDB-GENE-081104-399 Length:835 Species:Danio rerio


Alignment Length:266 Identity:82/266 - (30%)
Similarity:116/266 - (43%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLHLENVQNSSTPINVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSP-WAVKRITQNMRV-KKD 72
            |.||   |.|....|       :.:|.|:..:||:       |:.|:. .|:||...|... |.|
Zfish   455 NFHL---QLSELEFN-------EIIGSGSFGKVYK-------GKCRNKIVAIKRYRPNTYCSKSD 502

  Fly    73 TLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDE----DLGP 133
            |   :....|..||.:|.||.::.|.|...:|.  :..|:.....|.||:....|::    ||  
Zfish   503 T---DMFCREVSILCRLNHPCVIQFVGACLDDP--SQFAIVTQYVSGGSLFSLLHEQKRIIDL-- 560

  Fly   134 LPAKHTYKMI--MDVAQALDFLHNEAH-LMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEV 195
                 ..|:|  :|||:.:::|||... ::|.||.|.|:|:. |.....:.|||.|..|....|.
Zfish   561 -----QSKLIIAIDVAKGMEYLHNLTQPIIHRDLNSHNILLY-EDGHAVVADFGESRFLLSVDED 619

  Fly   196 NFLKNPGLRYVGTNL-WCAPEVIDEVDVIDSKADIFSFGLVIYETLALVPPHTLELDAALGEDMD 259
            |..|.||      || |.||||..:......|||:||:.|.::|.|....|......||...||.
Zfish   620 NMTKQPG------NLRWMAPEVFTQCTRYTVKADMFSYALCLWELLTGEIPFAHLKPAAAAADMA 678

  Fly   260 SSHDLP 265
            ..|..|
Zfish   679 YHHVRP 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 76/248 (31%)
S_TKc 30..>245 CDD:214567 69/224 (31%)
tnni3kNP_001191752.1 ANK <56..121 CDD:238125
Ank_4 67..121 CDD:290365
ANK repeat 67..98 CDD:293786
ANK 99..220 CDD:238125
ANK repeat 100..131 CDD:293786
Ank_2 105..195 CDD:289560
ANK repeat 136..164 CDD:293786
ANK 161..290 CDD:238125
ANK repeat 166..197 CDD:293786
Ank_2 171..261 CDD:289560
ANK repeat 199..232 CDD:293786
ANK 229..360 CDD:238125
ANK repeat 269..302 CDD:293786
Ank_2 274..369 CDD:289560
ANK repeat 304..337 CDD:293786
ANK 334..>401 CDD:238125
ANK repeat 339..369 CDD:293786
Ank_2 344..>411 CDD:289560
TyrKc 463..719 CDD:197581 77/255 (30%)
PKc_TNNI3K 469..722 CDD:270966 76/242 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.