Sequence 1: | NP_573239.1 | Gene: | CG8173 / 32753 | FlyBaseID: | FBgn0030864 | Length: | 398 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001191752.1 | Gene: | tnni3k / 799621 | ZFINID: | ZDB-GENE-081104-399 | Length: | 835 | Species: | Danio rerio |
Alignment Length: | 266 | Identity: | 82/266 - (30%) |
---|---|---|---|
Similarity: | 116/266 - (43%) | Gaps: | 46/266 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 NLHLENVQNSSTPINVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSP-WAVKRITQNMRV-KKD 72
Fly 73 TLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDE----DLGP 133
Fly 134 LPAKHTYKMI--MDVAQALDFLHNEAH-LMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEV 195
Fly 196 NFLKNPGLRYVGTNL-WCAPEVIDEVDVIDSKADIFSFGLVIYETLALVPPHTLELDAALGEDMD 259
Fly 260 SSHDLP 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8173 | NP_573239.1 | PKc_like | 28..389 | CDD:304357 | 76/248 (31%) |
S_TKc | 30..>245 | CDD:214567 | 69/224 (31%) | ||
tnni3k | NP_001191752.1 | ANK | <56..121 | CDD:238125 | |
Ank_4 | 67..121 | CDD:290365 | |||
ANK repeat | 67..98 | CDD:293786 | |||
ANK | 99..220 | CDD:238125 | |||
ANK repeat | 100..131 | CDD:293786 | |||
Ank_2 | 105..195 | CDD:289560 | |||
ANK repeat | 136..164 | CDD:293786 | |||
ANK | 161..290 | CDD:238125 | |||
ANK repeat | 166..197 | CDD:293786 | |||
Ank_2 | 171..261 | CDD:289560 | |||
ANK repeat | 199..232 | CDD:293786 | |||
ANK | 229..360 | CDD:238125 | |||
ANK repeat | 269..302 | CDD:293786 | |||
Ank_2 | 274..369 | CDD:289560 | |||
ANK repeat | 304..337 | CDD:293786 | |||
ANK | 334..>401 | CDD:238125 | |||
ANK repeat | 339..369 | CDD:293786 | |||
Ank_2 | 344..>411 | CDD:289560 | |||
TyrKc | 463..719 | CDD:197581 | 77/255 (30%) | ||
PKc_TNNI3K | 469..722 | CDD:270966 | 76/242 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |