DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and mos

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_991143.1 Gene:mos / 795517 ZFINID:ZDB-GENE-040428-3 Length:329 Species:Danio rerio


Alignment Length:211 Identity:59/211 - (27%)
Similarity:94/211 - (44%) Gaps:52/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AVKRI--TQNMRVKKDTLFNE-RIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCT---- 116
            |||::  .:|....:.:.:.| ...|       |.|.|||            ..||...||    
Zfish    85 AVKKVKCVKNKLASRQSFWAELNAAH-------LHHQNIV------------RVLAATTCTPAHL 130

  Fly   117 ---TSLGSILEERHDE-----------DLGPLPAKHTYKMIMDVAQALDFLHNEAH-LMHGDLKS 166
               .::|:|:.|....           ||  ||.:...|..:|:|:||..||  || ::|.|||.
Zfish   131 NTKDNIGTIVMEFAGNINLQKLIYGLTDL--LPVEKCIKYSIDIARALQHLH--AHGVVHLDLKP 191

  Fly   167 FNVLVKGEFEICKLCDFGVSLPLDEQGE-VNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIF 230
            .|||: .|..:||:.|||.|..:....: |..:...|    ||....|||:: :.:.:..:.|::
Zfish   192 ANVLL-SEQGVCKIADFGCSFKISSTSDTVTHMNEIG----GTFTHRAPELL-KGEEVSPRVDVY 250

  Fly   231 SFGLVIYETLALVPPH 246
            |||:.:::.|...||:
Zfish   251 SFGITLWQLLTREPPY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 59/211 (28%)
S_TKc 30..>245 CDD:214567 57/208 (27%)
mosNP_991143.1 STKc_Mos 56..329 CDD:270881 59/211 (28%)
S_TKc 63..320 CDD:214567 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.