| Sequence 1: | NP_573239.1 | Gene: | CG8173 / 32753 | FlyBaseID: | FBgn0030864 | Length: | 398 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080006.3 | Gene: | Lrrk2 / 66725 | MGIID: | 1913975 | Length: | 2527 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 62/241 - (25%) |
|---|---|---|---|
| Similarity: | 105/241 - (43%) | Gaps: | 42/241 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 DTPRRKLRNLHLENVQNSSTPINVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSPWAVKRITQN 66
Fly 67 MRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDEDL 131
Fly 132 GPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVKGEFE----ICKLCDFGVSLPLDEQ 192
Fly 193 GEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYE 238 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8173 | NP_573239.1 | PKc_like | 28..389 | CDD:304357 | 58/215 (27%) |
| S_TKc | 30..>245 | CDD:214567 | 57/213 (27%) | ||
| Lrrk2 | NP_080006.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 957..979 | ||
| LRR 1 | 983..1004 | ||||
| leucine-rich repeat | 985..1012 | CDD:275380 | |||
| LRR 2 | 1012..1033 | ||||
| leucine-rich repeat | 1013..1036 | CDD:275380 | |||
| LRR 3 | 1036..1057 | ||||
| leucine-rich repeat | 1037..1059 | CDD:275380 | |||
| LRR 4 | 1059..1080 | ||||
| leucine-rich repeat | 1060..1084 | CDD:275380 | |||
| LRR 5 | 1084..1105 | ||||
| leucine-rich repeat | 1085..1108 | CDD:275380 | |||
| LRR 6 | 1108..1129 | ||||
| leucine-rich repeat | 1109..1130 | CDD:275380 | |||
| LRR 7 | 1130..1151 | ||||
| leucine-rich repeat | 1131..1170 | CDD:275380 | |||
| leucine-rich repeat | 1171..1197 | CDD:275380 | |||
| LRR 8 | 1174..1195 | ||||
| LRR 9 | 1197..1218 | ||||
| leucine-rich repeat | 1198..1221 | CDD:275380 | |||
| LRR 10 | 1221..1242 | ||||
| leucine-rich repeat | 1222..1246 | CDD:275380 | |||
| LRR 11 | 1246..1267 | ||||
| LRR 12 | 1269..1291 | ||||
| leucine-rich repeat | 1270..1291 | CDD:275380 | |||
| Gem1 | 1333..1551 | CDD:224025 | |||
| RocCOR | 1334..1507 | CDD:206741 | |||
| COR | 1527..1740 | CDD:292713 | |||
| STKc_LRRK2 | 1884..2135 | CDD:270970 | 57/210 (27%) | ||
| S_TKc | 1884..2128 | CDD:214567 | 57/210 (27%) | ||
| WD 1 | 2139..2183 | ||||
| WD 2 | 2188..2228 | ||||
| WD 3 | 2233..2276 | ||||
| WD 4 | 2281..2327 | ||||
| WD 5 | 2333..2377 | ||||
| WD 6 | 2402..2438 | ||||
| WD 7 | 2443..2497 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||