DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and zak

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001314869.1 Gene:zak / 559247 ZFINID:ZDB-GENE-070912-386 Length:789 Species:Danio rerio


Alignment Length:194 Identity:62/194 - (31%)
Similarity:97/194 - (50%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEIRSPWAVKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITN--DEGINTLALEM 114
            |...|.:..:.::|:..|....|.  :|..||:||..|.|.||:.|.|.|..  :.||.|.    
Zfish    25 GSFGSVYRARWLSQDREVAVKKLL--KIEKEAEILSVLSHRNIIKFYGAILEAPNYGIVTE---- 83

  Fly   115 CTTSLGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEA--HLMHGDLKSFNVLVKGEFEI 177
             ..|.||:.:....:|...:..:......||:|:.:.:||:||  .::|.||||.||::..: .:
Zfish    84 -YASGGSLFDYLSSDDSEDISMQQIMTWAMDIAKGMHYLHSEAPVKVIHRDLKSRNVVLSSD-SV 146

  Fly   178 CKLCDFGVSLPLDEQGEVNFLKN-PGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETL 240
            .|:||||.|         .|..: ..:..|||..|.|||||..:.|.:: .|.||:|:|::|.|
Zfish   147 LKICDFGAS---------KFHSHTTHMSLVGTFPWMAPEVIQSLPVSET-CDTFSYGVVLWEML 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 62/194 (32%)
S_TKc 30..>245 CDD:214567 62/194 (32%)
zakNP_001314869.1 STYKc 16..260 CDD:214568 62/194 (32%)
PKc_like 22..263 CDD:304357 62/194 (32%)
SAM_MLTK 338..405 CDD:188928
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.