DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and map3k7

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_009292938.1 Gene:map3k7 / 553788 ZFINID:ZDB-GENE-041001-135 Length:578 Species:Danio rerio


Alignment Length:330 Identity:80/330 - (24%)
Similarity:122/330 - (36%) Gaps:81/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RSPW-----AVKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEM 114
            ::.|     |:|.|      :.::..|..|| |...|.::.|||||...|...     |.:.|.|
Zfish    41 KAKWKGRDVAIKTI------ESESEKNAFIV-ELRQLSRVDHPNIVKLYGSCN-----NPVCLVM 93

  Fly   115 CTTSLGSILEERHDEDLGPLP---AKHTYKMIMDVAQALDFLH--NEAHLMHGDLKSFNVLVKGE 174
            .....||:....|..:  |||   |.|.....:..:|.:.:||  ....|:|.|||..|:|:...
Zfish    94 EYAEGGSLYNVLHGAE--PLPHYTASHAMSWCLQCSQGVSYLHGMKPKALIHRDLKPPNLLLVAG 156

  Fly   175 FEICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYET 239
            ..:.|:||||.:..:    :.:...|.     |:..|.||||. |......|.|:||:|::::|.
Zfish   157 GTVLKICDFGTACDI----QTHMTNNK-----GSAAWMAPEVF-EGSNYSEKCDVFSWGIILWEV 211

  Fly   240 LALVPPHTLELDAALGEDMDSSHDLPTDTDKLQCKQLDFSSDENKNGLPSAMEEHTDNDMSQDYD 304
            :....|.. |:.......|.:.|   ..|.....|           .||.|:|.......|:|..
Zfish   212 ITRRKPFD-EIGGPAFRIMWAVH---RGTRPPLIK-----------NLPKAIESLMTRCWSKDPS 261

  Fly   305 EEDDEEEKEEEEEDDEEDDDTKENDISYFTLNNLHSAYGTRPPLPVAFQLSD------------- 356
            :....||..:          ...:.:.||.        |:..||...:|.||             
Zfish   262 QRPSMEEIVK----------IMSHLMGYFP--------GSEEPLKYPYQYSDEGQSNSATSTGSH 308

  Fly   357 -DYNC 360
             ||.|
Zfish   309 LDYTC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 80/330 (24%)
S_TKc 30..>245 CDD:214567 55/199 (28%)
map3k7XP_009292938.1 TyrKc 25..273 CDD:197581 69/280 (25%)
STKc_TAK1 31..281 CDD:270960 70/288 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.