DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and RIPK4

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_065690.2 Gene:RIPK4 / 54101 HGNCID:496 Length:784 Species:Homo sapiens


Alignment Length:361 Identity:78/361 - (21%)
Similarity:136/361 - (37%) Gaps:80/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WAVKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALE-MCTTSLGS 121
            |...:.:.::.|  |......::.||..:...|...|:...|:.....|   |.:| |.|.||..
Human    47 WLAIKCSPSLHV--DDRERMELLEEAKKMEMAKFRYILPVYGICREPVG---LVMEYMETGSLEK 106

  Fly   122 ILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEA-HLMHGDLKSFNVLVKGEFEICKLCDFGV 185
            :|...      |||....:::|.:.|..::|||..| .|:|.|||..|:|:...:.: |:.|||:
Human   107 LLASE------PLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHV-KISDFGL 164

  Fly   186 SLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVD-VIDSKADIFSFGLVIYETLAL------- 242
            : ..:.....:.|...||  .||..:..||.|.|.. :.|:|.|::||.:||:..|..       
Human   165 A-KCNGLSHSHDLSMDGL--FGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADE 226

  Fly   243 -----------------VPP----------HTLEL-----------DAALGEDMDSSHDL---PT 266
                             :||          |.:.|           .....|....:.||   |.
Human   227 KNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQEITSETEDLCEKPD 291

  Fly   267 DTDKLQCKQLDFSS--DENKNGLPSAMEEHTDNDMSQDYDEED-----DEEEKEEEEEDDEEDDD 324
            |..|.....||..|  :.....:|:.::..:......||...:     |....:..|..:|....
Human   292 DEVKETAHDLDVKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRS 356

  Fly   325 TKENDI-------SYFTLNNLHSAYGTRPPLPVAFQ 353
            :.|:.:       ....::::.||:.:|..|.::|:
Human   357 SSESKLPSSGSGKRLSGVSSVDSAFSSRGSLSLSFE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 78/361 (22%)
S_TKc 30..>245 CDD:214567 53/213 (25%)
RIPK4NP_065690.2 STKc_RIP4_like 25..290 CDD:270927 60/257 (23%)
STYKc 26..279 CDD:214568 57/246 (23%)
ANK 413..524 CDD:238125
ANK repeat 437..468 CDD:293786
Ank_2 442..534 CDD:289560
ANK repeat 470..501 CDD:293786
ANK 471..589 CDD:238125
ANK repeat 503..534 CDD:293786
Ank_2 508..600 CDD:289560
ANK repeat 536..567 CDD:293786
ANK repeat 569..600 CDD:293786
ANK 598..723 CDD:238125
ANK repeat 603..634 CDD:293786
Ank_2 608..699 CDD:289560
ANK repeat 636..667 CDD:293786
ANK repeat 669..699 CDD:293786
Ank_2 674..764 CDD:289560
ANK 729..>764 CDD:238125
ANK repeat 734..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.