| Sequence 1: | NP_573239.1 | Gene: | CG8173 / 32753 | FlyBaseID: | FBgn0030864 | Length: | 398 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_057062.1 | Gene: | TNNI3K / 51086 | HGNCID: | 19661 | Length: | 835 | Species: | Homo sapiens |
| Alignment Length: | 241 | Identity: | 75/241 - (31%) |
|---|---|---|---|
| Similarity: | 107/241 - (44%) | Gaps: | 34/241 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 LGHGTGIRVYRLDRSPRLGEIRSP-WAVKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGF 97
Fly 98 RGVITNDEGINTLALEMCTTSLGSILEERHDE----DLGPLPAKHTYKMI--MDVAQALDFLHNE 156
Fly 157 AH-LMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNL-WCAPEVIDE 219
Fly 220 VDVIDSKADIFSFGLVIYETLALVPPHTLELDAALGEDMDSSHDLP 265 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8173 | NP_573239.1 | PKc_like | 28..389 | CDD:304357 | 75/241 (31%) |
| S_TKc | 30..>245 | CDD:214567 | 68/219 (31%) | ||
| TNNI3K | NP_057062.1 | ANK | <56..121 | CDD:238125 | |
| ANK repeat | 66..98 | CDD:293786 | |||
| ANK 1 | 66..96 | ||||
| ANK | 99..220 | CDD:238125 | |||
| ANK repeat | 100..131 | CDD:293786 | |||
| ANK 2 | 100..129 | ||||
| ANK 3 | 133..162 | ||||
| ANK repeat | 134..164 | CDD:293786 | |||
| ANK | 161..290 | CDD:238125 | |||
| ANK repeat | 166..197 | CDD:293786 | |||
| ANK 4 | 166..195 | ||||
| ANK repeat | 199..232 | CDD:293786 | |||
| ANK 5 | 199..228 | ||||
| ANK | 229..360 | CDD:238125 | |||
| ANK 6 | 234..263 | ||||
| ANK repeat | 234..262 | CDD:293786 | |||
| ANK repeat | 269..302 | CDD:293786 | |||
| ANK 7 | 269..298 | ||||
| ANK repeat | 304..337 | CDD:293786 | |||
| ANK 8 | 304..335 | ||||
| ANK | 334..>401 | CDD:238125 | |||
| ANK repeat | 339..369 | CDD:293786 | |||
| ANK 9 | 339..368 | ||||
| ANK 10 | 381..410 | ||||
| PKc_TNNI3K | 469..722 | CDD:270966 | 75/241 (31%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 732..751 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||