DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and slpr

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:314 Identity:72/314 - (22%)
Similarity:115/314 - (36%) Gaps:87/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTT-------SLGSI 122
            |.||        :.::.||.:...|||.||...|||..|        .::|..       ||..|
  Fly   167 QRMR--------DNVLQEAKLFWALKHENIAALRGVCLN--------TKLCLVMEYARGGSLNRI 215

  Fly   123 LEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEA--HLMHGDLKSFNVLVKGEFE-------IC 178
            |       .|.:|........:.:|:.:::|||||  .::|.||||.|||:....|       ..
  Fly   216 L-------AGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTL 273

  Fly   179 KLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYE----- 238
            |:.|||::..:        .....:...||..|..|||| .|......:|::|:|::::|     
  Fly   274 KITDFGLAREM--------YNTQRMSAAGTYAWMPPEVI-SVSTYSKFSDVWSYGVLLWELITGE 329

  Fly   239 ------------------TLALVPPHTL-ELDAALGED--MDSSHDLP------TDTDKLQCKQL 276
                              ||.|..|.|. |...||.:.  ....|..|      ...:.:.|.:.
  Fly   330 TPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSKF 394

  Fly   277 DFSSDENKNGLPSAMEEHTDNDMSQDYDEEDDEEEKEEEEEDDEEDDDTKENDI 330
            ..:..|:.:.:.....:.....:       .|..|||:..:..||:...||..:
  Fly   395 TLTPQESFHYMQECWRKEIAGVL-------HDLREKEKRFQTIEEELRNKEEQL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 72/314 (23%)
S_TKc 30..>245 CDD:214567 55/218 (25%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 62/250 (25%)
STKc_MLK 134..389 CDD:270963 62/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.