DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and MOS

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_005363.1 Gene:MOS / 4342 HGNCID:7199 Length:346 Species:Homo sapiens


Alignment Length:271 Identity:68/271 - (25%)
Similarity:118/271 - (43%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MMKTLGHGTGIRVYRLDRSPRLGEIRS-PWAVKRI---TQNMRVKKDTLFNERIVHEADILRKLK 90
            :::.||.|....||:       ...|. |.|:|::   |:|....:.:.:.|..|      .:|:
Human    62 LLQRLGAGGFGSVYK-------ATYRGVPVAIKQVNKCTKNRLASRRSFWAELNV------ARLR 113

  Fly    91 HPNIVGFRGVIT----NDEGINTLALEM-CTTSLGSIL-----------EERHDEDLGPLPAKHT 139
            |.|||......|    ....:.|:.:|. ...:|..::           .|.|....|.|.....
Human   114 HDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKC 178

  Fly   140 YKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGLR 204
            .|..:||...|.|||::: ::|.|||..|:|: .|.::||:.|||.|..|:   ::...:.|...
Human   179 LKYSLDVVNGLLFLHSQS-IVHLDLKPANILI-SEQDVCKISDFGCSEKLE---DLLCFQTPSYP 238

  Fly   205 YVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETLALVPPHTLE----LDAALGEDMDSSHDLP 265
            ..||....|||:: :.:.:..||||:||.:.:::......|::.|    |.|.:..|:..|....
Human   239 LGGTYTHRAPELL-KGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAA 302

  Fly   266 TDTDKLQCKQL 276
            ...|.|..::|
Human   303 VFEDSLPGQRL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 68/271 (25%)
S_TKc 30..>245 CDD:214567 59/234 (25%)
MOSNP_005363.1 STKc_Mos 56..338 CDD:270881 68/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3817
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.