DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and MAP3K10

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_011525283.1 Gene:MAP3K10 / 4294 HGNCID:6849 Length:962 Species:Homo sapiens


Alignment Length:335 Identity:84/335 - (25%)
Similarity:143/335 - (42%) Gaps:72/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LGHGTGIRVYR-LDRSPRLGEIRSPWAVKRITQNMRVKKD-TLFNERIVHEADILRKLKHPNIVG 96
            :|.|...:||| |.|...:       |||  ...:..:|| .:..|::..||.:...|:||||:.
Human   104 IGVGGFGKVYRALWRGEEV-------AVK--AARLDPEKDPAVTAEQVCQEARLFGALQHPNIIA 159

  Fly    97 FRGVITNDEGINTLALEMCT-TSLGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEA--H 158
            .||...|...: .|.:|... .:|..:|..|.      :|........:.||:.:::|||:|  .
Human   160 LRGACLNPPHL-CLVMEYARGGALSRVLAGRR------VPPHVLVNWAVQVARGMNYLHNDAPVP 217

  Fly   159 LMHGDLKSFNVLVKGEFE-------ICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEV 216
            ::|.||||.|:|:....|       :.|:.|||::.        .:.|...:...||..|.||||
Human   218 IIHRDLKSINILILEAIENHNLADTVLKITDFGLAR--------EWHKTTKMSAAGTYAWMAPEV 274

  Fly   217 IDEVDVIDSKADIFSFGLVIYETLALVPPHTLELDA---ALGEDMDS-SHDLPTDTDKLQCKQLD 277
            | .:.:....:|::|||::::|.|....|:. |:||   |.|..|:. :..:|:...:...:.|:
Human   275 I-RLSLFSKSSDVWSFGVLLWELLTGEVPYR-EIDALAVAYGVAMNKLTLPIPSTCPEPFARLLE 337

  Fly   278 FSS--------DENKNGLPS-----------------AMEEHTDNDMSQDYDEE-----DDEEEK 312
            ...        |.:.:|.|.                 .|...:.:.:.:|:..|     ||...|
Human   338 GEPGPRDEECWDPDPHGRPDFGSILKRLEVIEQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTK 402

  Fly   313 EEEEEDDEED 322
            |:|....||:
Human   403 EKELRSREEE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 84/335 (25%)
S_TKc 30..>245 CDD:214567 62/222 (28%)
MAP3K10XP_011525283.1 SH3_MLK1-3 20..76 CDD:212992
TyrKc 98..365 CDD:197581 74/286 (26%)
PKc_like 103..368 CDD:304357 74/289 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.