DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Takl2

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:107/253 - (42%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 STPINVPPSPMMKT---LGHGTGIRVYRLDRSPRLGEIRSPW-----AVKRITQNMRVKKDTLFN 76
            |.|:...|...::|   :|.|....||           |:.|     |:|||.:....||    .
  Fly     2 SAPVEGVPYEEIQTKELIGTGFYGSVY-----------RAVWRNREIALKRIREGCEDKK----I 51

  Fly    77 ERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCT-TSLGSILEERHDEDLGPLPAKHTY 140
            ||.:::   |.|..|.|||...|. :..||...|.:|... .||.|.|   |.:........|.:
  Fly    52 EREIYQ---LTKASHVNIVELYGT-SRHEGCALLLMEFVDGGSLSSFL---HAKSKPSYSHAHAF 109

  Fly   141 KMIMDVAQALDFLH--NEAHLMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGL 203
            .....:||.:.:||  ....::|.|:|..|.|:..:....|:||||..:.|.:....|       
  Fly   110 NWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCN------- 167

  Fly   204 RYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETLALVPP----HTL-ELDAALGE 256
              .||..:.||||: :.:..|.|.|::|:.:..:|.|:...|    :|| ||..|:.|
  Fly   168 --AGTCRYKAPEVL-QGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 67/245 (27%)
S_TKc 30..>245 CDD:214567 60/225 (27%)
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 67/241 (28%)
PKc_like 19..268 CDD:304357 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.