DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Mos

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:346 Identity:88/346 - (25%)
Similarity:138/346 - (39%) Gaps:112/346 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTPRRK--LRNLHLENVQNSSTPINVPPSP-MMKTLG---HGTGIRVYRLDRSPRLGEIRSPWA 59
            ::||:||  |:              :.||.| ..:.||   :||..:....|||..:..||:..|
  Fly     6 LNTPKRKQLLK--------------DGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKIIRAQAA 56

  Fly    60 VKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILE 124
                        .||.||.  |    |..|:|.|||            ..|.|| .....|.::.
  Fly    57 ------------STLHNES--H----LLNLEHRNIV------------RLLKLE-SAADFGLVIM 90

  Fly   125 E-------RHDEDLGPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVL------------ 170
            |       :...|...||..|...:.:||..||.:.|:: :::|.|:|..|:|            
  Fly    91 ECPRGQSLQRIVDTLALPLMHRVLITLDVVAALRYCHSQ-NVLHLDVKPTNILVALGTKSSITCN 154

  Fly   171 -----VKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIF 230
                 ||..: ||||||||.|:   |.||....:.|.:. .||..:.:||.: ..|.:...:||:
  Fly   155 SSKIKVKRSY-ICKLCDFGSSI---EMGEFCAWQEPSVA-KGTLRYMSPEAL-RSDTLTEASDIY 213

  Fly   231 SFGLVIYETLA-LVPPHTLE--------------------------LDAALGEDMDSSHDLPTDT 268
            |.|:.:::..| .:|.|||:                          ||:.:..|.|.:|:   .|
  Fly   214 SLGITMWQLQARRLPYHTLDCNETIAYQVVKHELRPDNYHQLKILALDSPIDCDWDLAHE---ST 275

  Fly   269 DKLQCKQLDFSSDENKNGLPS 289
            ..:.|::.:.|:..|.:..||
  Fly   276 ANVICRRANTSARRNLSLDPS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 81/317 (26%)
S_TKc 30..>245 CDD:214567 65/242 (27%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 83/319 (26%)
S_TKc 26..257 CDD:214567 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.