DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Takl1

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:309 Identity:77/309 - (24%)
Similarity:135/309 - (43%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KTLGHGTGIRVYRLDRSPRLGEIRSPWAVKRIT---QNMRVKKDTLFNERIVHEAD----ILRKL 89
            |.||.|:|                  .||::.|   |.:.||......|.|...|:    .|.::
  Fly    15 KFLGAGSG------------------GAVRKATFQNQEIAVKIFDFLEETIKKNAEREITHLSEI 61

  Fly    90 KHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFLH 154
            .|.|::...|..:|.:. :.|.:|....  ||:....:.:|......:...:..:..|:||.:||
  Fly    62 DHENVIRVIGRASNGKK-DYLLMEYLEE--GSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLH 123

  Fly   155 N-EAHLMHGDLKSFNVLVKGEFEICKLCDFGVSLPL-----DEQGEVNFLKNPGLRYVGTNLWCA 213
            : :..::|.|:|..|:|:..:.|..|:||||::..:     |.||.        |||:      |
  Fly   124 SLDRPIVHRDIKPQNMLLYNQHEDLKICDFGLATDMSNNKTDMQGT--------LRYM------A 174

  Fly   214 PEVIDEVDVIDSKADIFSFGLVIYETLALVPPHT-LE---LDAALGEDMDSSHDLPTDTDKLQC- 273
            ||.|..:. ..:|.|::|||::::|.:....|:: ||   ...|:.:.:.|...||.:..:..| 
  Fly   175 PEAIKHLK-YTAKCDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCP 238

  Fly   274 ---KQL-DFSSDENKNGLPSAMEEHTDNDMSQDYDEEDDEEEKEEEEED 318
               ||| :...|.|....||..|  .:..:.:.|:...||:..:..:||
  Fly   239 EGIKQLMECCMDINPEKRPSMKE--IEKFLGEQYESGTDEDFIKPLDED 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 77/309 (25%)
S_TKc 30..>245 CDD:214567 56/225 (25%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 72/284 (25%)
STKc_TAK1 17..274 CDD:270960 72/294 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.