DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Ripk4

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001100573.1 Gene:Ripk4 / 304053 RGDID:1311691 Length:786 Species:Rattus norvegicus


Alignment Length:297 Identity:67/297 - (22%)
Similarity:110/297 - (37%) Gaps:78/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WAVKRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALE-MCTTSLGS 121
            |...:.:.::.|  |......::.||..:...|...|:...|:.....|   |.:| |.|.||..
  Rat    47 WLAIKCSPSLHV--DDRERTELLEEAKKMEMAKFRYILPVYGICQEPVG---LVMEYMETGSLEK 106

  Fly   122 ILEERHDEDLGPLPAKHTYKMIMDVAQALDFLH-NEAHLMHGDLKSFNVLVKGEFEICKLCDFGV 185
            :|...      |||....::::.:.|..::||| ....|:|.|||..|:|:...:.: |:.|||:
  Rat   107 LLASE------PLPWDLRFRIVHETAVGMNFLHCMSPPLLHLDLKPANILLDAHYHV-KISDFGL 164

  Fly   186 SLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVD-VIDSKADIFSFGLVIYETLALVPPHTLE 249
            : ..:.....:.|...||  .||..:..||.|.|.. :.|:|.|::||.:||:..|....|    
  Rat   165 A-KCNGMSHSHDLSMDGL--FGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKP---- 222

  Fly   250 LDAALGEDMDSSHDLPTDTDKLQCKQLDFSSDEN------------KNGLP-------------- 288
                                        ||.::|            :..||              
  Rat   223 ----------------------------FSDEKNILHIMMKVVKGHRPELPPICRPRPRACASLI 259

  Fly   289 SAMEE--HTDNDMSQDYDEEDDEEEKEEEEEDDEEDD 323
            ..|:.  |.|..:...:.|...|.|...|:.|:|..|
  Rat   260 GLMQRCWHADPQVRPTFQEITSETEDLCEKPDEEVKD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 67/297 (23%)
S_TKc 30..>245 CDD:214567 51/189 (27%)
Ripk4NP_001100573.1 STKc_RIP4_like 25..290 CDD:270927 64/289 (22%)
TyrKc 26..279 CDD:197581 60/278 (22%)
ANK repeat 442..470 CDD:293786
Ank_2 444..536 CDD:289560
ANK 471..591 CDD:238125
ANK repeat 473..503 CDD:293786
ANK repeat 505..536 CDD:293786
ANK repeat 538..569 CDD:293786
Ank_2 544..634 CDD:289560
ANK repeat 571..602 CDD:293786
ANK 600..725 CDD:238125
ANK repeat 605..636 CDD:293786
Ank_2 610..701 CDD:289560
ANK repeat 638..669 CDD:293786
ANK repeat 671..701 CDD:293786
Ank_2 676..766 CDD:289560
ANK 731..>766 CDD:238125
ANK repeat 736..766 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.