DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Lrrk2

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001178718.1 Gene:Lrrk2 / 300160 RGDID:1561168 Length:2526 Species:Rattus norvegicus


Alignment Length:241 Identity:62/241 - (25%)
Similarity:105/241 - (43%) Gaps:42/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTPRRKLRNLHLENVQNSSTPINVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSPWAVKRITQN 66
            |.||         |:..::..:....:|.. .||.|:...||   |:...||   ..|||...::
  Rat  1862 DLPR---------NIMLNNDELEFEEAPEF-LLGDGSFGSVY---RAAYEGE---EVAVKIFNKH 1910

  Fly    67 MRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDEDL 131
            ..::   |..:.:|    :|..|.||:::.....     ||....|.|...|.|| |:....:|.
  Rat  1911 TSLR---LLRQELV----VLCHLHHPSLISLLAA-----GIRPRMLVMELASKGS-LDRLLQQDK 1962

  Fly   132 GPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVKGEFE----ICKLCDFGVSLPLDEQ 192
            ..|.....:::.:.||..|.:||: |.:::.|||..|||:...:.    |.|:.|:|::......
  Rat  1963 ASLTRTLQHRIALHVADGLRYLHS-AMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRM 2026

  Fly   193 GEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYE 238
            |.......||.|        ||||.....:.:.:||::||||::::
  Rat  2027 GIKTSEGTPGFR--------APEVARGNVIYNQQADVYSFGLLLHD 2064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 58/215 (27%)
S_TKc 30..>245 CDD:214567 57/213 (27%)
Lrrk2NP_001178718.1 leucine-rich repeat 984..1011 CDD:275380
leucine-rich repeat 1012..1035 CDD:275380
leucine-rich repeat 1036..1058 CDD:275380
leucine-rich repeat 1059..1083 CDD:275380
leucine-rich repeat 1084..1107 CDD:275380
leucine-rich repeat 1108..1129 CDD:275380
leucine-rich repeat 1130..1173 CDD:275380
leucine-rich repeat 1174..1196 CDD:275380
leucine-rich repeat 1197..1220 CDD:275380
leucine-rich repeat 1221..1245 CDD:275380
Gem1 1332..1550 CDD:224025
RocCOR 1333..1506 CDD:206741
COR 1526..1739 CDD:292713
S_TKc 1883..2145 CDD:214567 57/210 (27%)
STKc_LRRK2 1883..2134 CDD:270970 57/210 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.