DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Map3k7

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_033342.1 Gene:Map3k7 / 26409 MGIID:1346877 Length:606 Species:Mus musculus


Alignment Length:257 Identity:68/257 - (26%)
Similarity:112/257 - (43%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RSPWAVKRITQNMRVKKDTLFNER--IVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTT 117
            ::.|..|    ::.:|:....:||  .:.|...|.::.|||||...|..     :|.:.|.|...
Mouse    52 KAKWRAK----DVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGAC-----LNPVCLVMEYA 107

  Fly   118 SLGSILEERHDEDLGPLP---AKHTYKMIMDVAQALDFLHN--EAHLMHGDLKSFNVLVKGEFEI 177
            ..||:....|..:  |||   |.|.....:..:|.:.:||:  ...|:|.|||..|:|:.....:
Mouse   108 EGGSLYNVLHGAE--PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTV 170

  Fly   178 CKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETLAL 242
            .|:||||.:..:    :.:...|.     |:..|.||||. |......|.|:||:|::::|.:..
Mouse   171 LKICDFGTACDI----QTHMTNNK-----GSAAWMAPEVF-EGSNYSEKCDVFSWGIILWEVITR 225

  Fly   243 VPPHTLELDAALGEDMDSSH---------DLPTDTDKL--QCKQLDFSSDENKNGLPSAMEE 293
            ..|.. |:.......|.:.|         :||...:.|  :|    :|.|.::.  || |||
Mouse   226 RKPFD-EIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRC----WSKDPSQR--PS-MEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 68/257 (26%)
S_TKc 30..>245 CDD:214567 53/196 (27%)
Map3k7NP_033342.1 STKc_TAK1 42..292 CDD:270960 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.