DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Map3k11

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_071295.2 Gene:Map3k11 / 26403 MGIID:1346880 Length:850 Species:Mus musculus


Alignment Length:334 Identity:78/334 - (23%)
Similarity:130/334 - (38%) Gaps:81/334 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KTLGHGTGIRVYRLDRSPRLGEIRSPW-----AVKRITQNMRVKKD-TLFNERIVHEADILRKLK 90
            :.:|.|...:||           |..|     |||...|:  ..:| ::..|.:..||.:...|.
Mouse   122 EVIGIGGFGKVY-----------RGSWRGELVAVKAARQD--PDEDISVTAESVRQEARLFAMLA 173

  Fly    91 HPNIVGFRGVITNDEGINTLALEMCTTS-LGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFLH 154
            ||||:..:.|...:..: .|.:|..... |...|..|.      :|........:.:|:.:.:||
Mouse   174 HPNIIALKAVCLEEPNL-CLVMEYAAGGPLSRALAGRR------VPPHVLVNWAVQIARGMHYLH 231

  Fly   155 NEA--HLMHGDLKSFNVL----VKG---EFEICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNL 210
            .||  .::|.||||.|:|    ::|   |.:..|:.|||::.        .:.|...:...||..
Mouse   232 CEALVPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAR--------EWHKTTQMSAAGTYA 288

  Fly   211 WCAPEVIDEVDVIDSKADIFSFGLVIYETLALVPPH-----------------TLELDAALGEDM 258
            |.||||| :.......:|::|||::::|.|....|:                 ||.:.:...|..
Mouse   289 WMAPEVI-KASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPF 352

  Fly   259 ---------DSSHDLPTDTDKLQCKQLDFSSDENKNGLP----SAMEEHTDNDMSQDYDE----E 306
                     ...|..|.....||  ||:....:....:|    .:|:|....::...:||    |
Mouse   353 AQLMADCWAQDPHRRPDFASILQ--QLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKE 415

  Fly   307 DDEEEKEEE 315
            .:...:|||
Mouse   416 KELLSREEE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 78/334 (23%)
S_TKc 30..>245 CDD:214567 59/228 (26%)
Map3k11NP_071295.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..35
SH3_MLK1-3 46..103 CDD:212992
STKc_MLK3 114..380 CDD:271049 69/288 (24%)
Leucine-zipper 1 404..425 6/21 (29%)
Leucine-zipper 2 439..460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 657..850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.