DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and ANKK1

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_011541038.1 Gene:ANKK1 / 255239 HGNCID:21027 Length:776 Species:Homo sapiens


Alignment Length:186 Identity:50/186 - (26%)
Similarity:94/186 - (50%) Gaps:26/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IVHEADILRKLKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDEDLGPLPAKHT---- 139
            ::.||..::|:|..:||...||              |...||.::|...:..|..:.:.|:    
Human    68 LIEEAAKMKKIKFQHIVSIYGV--------------CKQPLGIVMEFMANGSLEKVLSTHSLCWK 118

  Fly   140 --YKMIMDVAQALDFLHN-EAHLMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEVNFLKNP 201
              :::|.:.:.|::|||: :..|:|.|||..|:|:.....: |:.|||:|..:::...:.:::..
Human   119 LRFRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDSNMHV-KISDFGLSKWMEQSTRMQYIERS 182

  Fly   202 GLRYVGTNLWCAPEVIDEVDVIDS-KADIFSFGLVIYETLALVPPHTLELDAALGE 256
            .||  |...:..||:..|.:.... |.|::||.:||:|.|....|:: ||.:.|.|
Human   183 ALR--GMLSYIPPEMFLESNKAPGPKYDVYSFAIVIWELLTQKKPYS-ELTSQLKE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 50/186 (27%)
S_TKc 30..>245 CDD:214567 45/173 (26%)
ANKK1XP_011541038.1 STKc_RIP4_like 25..303 CDD:270927 50/186 (27%)
S_TKc 26..291 CDD:214567 50/186 (27%)
ANK repeat 375..403 CDD:293786
Ank_2 377..468 CDD:289560
ANK 400..524 CDD:238125
ANK repeat 405..436 CDD:293786
ANK repeat 438..469 CDD:293786
Ank_2 443..534 CDD:289560
ANK repeat 471..502 CDD:293786
ANK 499..623 CDD:238125
ANK repeat 504..534 CDD:293786
ANK repeat 537..568 CDD:293786
Ank_4 539..591 CDD:290365
ANK 565..690 CDD:238125
ANK repeat 570..601 CDD:293786
Ank_2 575..665 CDD:289560
ANK repeat 603..634 CDD:293786
ANK 638..755 CDD:238125
ANK repeat 638..667 CDD:293786
Ank_2 641..733 CDD:289560
ANK repeat 669..700 CDD:293786
ANK repeat 702..733 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.