DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Dstyk

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_766104.2 Gene:Dstyk / 213452 MGIID:1925064 Length:927 Species:Mus musculus


Alignment Length:261 Identity:60/261 - (22%)
Similarity:105/261 - (40%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKLRNLH---LENVQNSSTPINVPPSPMMKTLG-HGTGIRVYRLDRSPRLGEI------------ 54
            |:|...|   ||..::....:....:|.:..|. ....::...|.|.|:||:.            
Mouse   603 RQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLC 667

  Fly    55 -----RSPWAVKRITQNMRVKKDTLFNERIVHEADILRKL-KHPNIVGFRGVIT--NDEGINTLA 111
                 ..|.|:|.:     |..|......:..|...:|.| ||..:|...|.:.  |..|.:::|
Mouse   668 DNWGGHFPCALKSV-----VPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVA 727

  Fly   112 LEMCTTSLGSILEERHDEDLGPLPAKHT----YKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVK 172
            :.:       |:|..|.:....|.|..|    .::.:||.:.:.|||::. |:|.|:|..|||:.
Mouse   728 VLL-------IMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQG-LVHRDIKLKNVLLD 784

  Fly   173 GEFEICKLCDFGVSLP-LDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVI 236
            .: ...|:.|.|...| ....|.:          |||.:..|||:.  ....|:..|:::||::.
Mouse   785 KQ-NRAKITDLGFCKPEAMMSGSI----------VGTPIHMAPELF--TGKYDNSVDVYAFGILF 836

  Fly   237 Y 237
            :
Mouse   837 W 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 55/236 (23%)
S_TKc 30..>245 CDD:214567 54/234 (23%)
DstykNP_766104.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 649..910 CDD:270877 51/215 (24%)
S_TKc 651..895 CDD:214567 50/213 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.