DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and MLKL

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_689862.1 Gene:MLKL / 197259 HGNCID:26617 Length:471 Species:Homo sapiens


Alignment Length:224 Identity:54/224 - (24%)
Similarity:103/224 - (45%) Gaps:40/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IRVYRLDRSP----RLGEI---------RSPWAVKRITQNMRVKKDTLFNERIVHEADILRKLKH 91
            |:..:|..||    |..|:         |:|.|:| :.:.::.....:..:....|...::|.:.
Human   196 IKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIK-VFKKLQAGSIAIVRQTFNKEIKTMKKFES 259

  Fly    92 PNIVGFRGVITNDEGIN----TLALEMCTT-SLGSILEERHDEDLGPLPAKHTYKMIMDVAQALD 151
            |||:...|:.. ||.:.    ::.:|.|.. :|..:|:...|..||     ....:::..|:.|.
Human   260 PNILRIFGICI-DETVTPPQFSIVMEYCELGTLRELLDREKDLTLG-----KRMVLVLGAARGLY 318

  Fly   152 FL-HNEAHLMHGDLKSFNVLVKGEFEICKLCDFGV-----SLPLDEQGEVNFLKNPGLRYVGTNL 210
            .| |:||..:||.::|.|.||...::: ||..|.:     |:.|....|..       ..|.:..
Human   319 RLHHSEAPELHGKIRSSNFLVTQGYQV-KLAGFELRKTQTSMSLGTTREKT-------DRVKSTA 375

  Fly   211 WCAPEVIDEVDV-IDSKADIFSFGLVIYE 238
            :.:|:.:::|.. .|.|::|:|||:|::|
Human   376 YLSPQELEDVFYQYDVKSEIYSFGIVLWE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 54/224 (24%)
S_TKc 30..>245 CDD:214567 54/224 (24%)
MLKLNP_689862.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000269|PubMed:29883610 1..149
PHA02988 177..469 CDD:165291 54/224 (24%)
PKc_like 215..466 CDD:304357 48/205 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.