DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8173 and Y53F4B.1

DIOPT Version :9

Sequence 1:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_497085.2 Gene:Y53F4B.1 / 190206 WormBaseID:WBGene00013149 Length:463 Species:Caenorhabditis elegans


Alignment Length:312 Identity:72/312 - (23%)
Similarity:113/312 - (36%) Gaps:88/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AVKRITQNMRVKKDTLFNERIVHEADILRKLKH-PNIV---------GFRGVITNDEGINTLALE 113
            ::|..|...|        |.|..||.::..|.: .|:|         .|||:|          :|
 Worm    52 SIKEYTDKER--------ENIRREARVVAALNNCENVVRIYGICETLPFRGMI----------ME 98

  Fly   114 MCTTSLGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFLHNEAHLMHGDLKSFNVLVK------ 172
            .|.....|.|..:.||..........:|...|:.:.|..|:  ....|||:|:.|||||      
 Worm    99 YCAGPNLSELVFQLDECKVKFETLRIFKWCHDLTRTLCELN--VTYYHGDVKAKNVLVKERPCCC 161

  Fly   173 --GEFE-------------IC----------KLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWC 212
              |.:|             ||          |:||||:|..         .|:..|...||..:.
 Worm   162 VEGIYENVKIRNTTYSLCTICNGVHLEHLSLKICDFGMSYE---------HKDKRLYNGGTREFS 217

  Fly   213 APEVIDEVDVIDSKADIFSFGLVIYETLALVPPHTLELDAALGEDM------DSSHDLPTDTDKL 271
            |||.|.  .:...|::::|||.::   |.||.....|.|.|:|:..      :..:|:.......
 Worm   218 APETIR--GIYTEKSEVYSFGHLM---LVLVIGGPTEDDCAVGQRAFLKMYNNKKYDMSGCKSNS 277

  Fly   272 QCKQLDFSSDENKNGLPSAME-------EHTDNDMSQDYDEEDDEEEKEEEE 316
            .|:.:::..:..:...|:..:       .||.....:..|....|...|.||
 Worm   278 ICETIEWCLNNTQESRPTFKQLLSKLNSRHTHYLSLRGTDTRRLEANNEREE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 72/312 (23%)
S_TKc 30..>245 CDD:214567 58/226 (26%)
Y53F4B.1NP_497085.2 PKc 29..303 CDD:270622 65/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.