DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and si:dkey-121a11.3

DIOPT Version :9

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_009294606.1 Gene:si:dkey-121a11.3 / 566840 ZFINID:ZDB-GENE-050208-417 Length:1060 Species:Danio rerio


Alignment Length:123 Identity:37/123 - (30%)
Similarity:59/123 - (47%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 TPVKTK--APSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGS---DKPLGFYIRDGTSVRVTA 186
            :||.|:  ..::|: .|..:.||:..|..|.:......:|...|   :.|.||.|..|..     
Zfish   934 SPVLTRDLQRALSV-EDVGRPSAVRPVGRVAQAFPDGTILLELSRPPNGPFGFLISRGKG----- 992

  Fly   187 SGLEKQPGIFISRLVPGGLAE-STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSS 243
               ....|:::..:....:.: ..|||.|.||::||||.:|||.:||.||.:|..||:
Zfish   993 ---RPDSGVYVEEMGDSNMEKLYAGLLGVGDEILEVNGEKVAGLSLDLVTRLMTQNST 1047

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724
PDZ_signaling 159..250 CDD:238492 28/89 (31%)
si:dkey-121a11.3XP_009294606.1 DUF4685 317..438 CDD:292365
PDZ_signaling 970..1053 CDD:238492 28/86 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14102
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.