DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and RGD1304622

DIOPT Version :9

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_008767912.1 Gene:RGD1304622 / 305101 RGDID:1304622 Length:1197 Species:Rattus norvegicus


Alignment Length:124 Identity:30/124 - (24%)
Similarity:62/124 - (50%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 APSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFI 197
            |||::     |.|..:  |::.|:...::: |:...:...||.:..|:.        .:..|:::
  Rat  1089 APSLA-----RTVGRV--VEVFPDGTSQLQ-LQRPPEGTFGFCVAYGSG--------RRDSGLYV 1137

  Fly   198 SRLVPGGLAE-STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQR 255
            ..:.....|: .:|||.|.||::|:||.:|||..|..:.:::|...|   ::::...||
  Rat  1138 QDMADLDTAKLYSGLLGVGDEILEMNGAKVAGLGLAHINELLVRVES---LSIRVLRQR 1193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724
PDZ_signaling 159..250 CDD:238492 21/91 (23%)
RGD1304622XP_008767912.1 DUF4685 345..468 CDD:292365
PDZ_signaling 1109..1190 CDD:238492 21/92 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14102
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.