DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and BC034090

DIOPT Version :10

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001357794.1 Gene:BC034090 / 207792 MGIID:2672904 Length:1202 Species:Mus musculus


Alignment Length:130 Identity:33/130 - (25%)
Similarity:64/130 - (49%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 APSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKP----LGFYIRDGTSVRVTASGLEKQP 193
            |||::     |.|..:  |::.|:...:::|     .:|    .||::..|:.        .:..
Mouse  1094 APSLA-----RTVGRV--VEVFPDGTSQLQL-----QRPPKGTFGFHVAHGSG--------RRDS 1138

  Fly   194 GIFISRLVPGGLAE-STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITV---KPANQ 254
            |:::..:.....|: .:|||.|.||::||.|.:|||..|..:.::: |::.:|.|.|   :|..|
Mouse  1139 GLYVQAMADLDTAKLYSGLLRVGDEILEVGGAKVAGLGLAHIKELL-AHAESLSIRVLRQRPVPQ 1202

  Fly   255  254
            Mouse  1203  1202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724
PDZ_Par6-like 159..251 CDD:467202 24/99 (24%)
BC034090NP_001357794.1 DUF4685 337..461 CDD:464834
PDZ_canonical 1117..1196 CDD:483948 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.