DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and BC034090

DIOPT Version :9

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001357794.1 Gene:BC034090 / 207792 MGIID:2672904 Length:1202 Species:Mus musculus


Alignment Length:130 Identity:33/130 - (25%)
Similarity:64/130 - (49%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 APSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKP----LGFYIRDGTSVRVTASGLEKQP 193
            |||::     |.|..:  |::.|:...:::|     .:|    .||::..|:.        .:..
Mouse  1094 APSLA-----RTVGRV--VEVFPDGTSQLQL-----QRPPKGTFGFHVAHGSG--------RRDS 1138

  Fly   194 GIFISRLVPGGLAE-STGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITV---KPANQ 254
            |:::..:.....|: .:|||.|.||::||.|.:|||..|..:.::: |::.:|.|.|   :|..|
Mouse  1139 GLYVQAMADLDTAKLYSGLLRVGDEILEVGGAKVAGLGLAHIKELL-AHAESLSIRVLRQRPVPQ 1202

  Fly   255  254
            Mouse  1203  1202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724
PDZ_signaling 159..250 CDD:238492 24/98 (24%)
BC034090NP_001357794.1 DUF4685 337..461 CDD:374064
PDZ_signaling 1114..1195 CDD:238492 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3606
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14102
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.