DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and C09G1.4

DIOPT Version :9

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_510621.2 Gene:C09G1.4 / 181679 WormBaseID:WBGene00007486 Length:545 Species:Caenorhabditis elegans


Alignment Length:222 Identity:62/222 - (27%)
Similarity:96/222 - (43%) Gaps:52/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PRDNDLLPINNDDNFGRALKTARPLL----RVIVQRKDDLNEYSG--FGTMK---------PRNL 118
            |...|.|.|||.:...|.|.|| ||:    ::.:...|:|..|..  |..|:         |::.
 Worm   331 PGSLDNLHINNLNMRRRKLPTA-PLMGSSCQLHLDNSDELTAYRALQFQMMQDELQRQQPPPQSF 394

  Fly   119 IGSILMGHT-----------PVKTKAP-----SISIPHDFRQ-------VSAIIDVDIVPETHRR 160
            ....|:..|           .:.|..|     .:|:|..:.|       |.|.: |.:.....||
 Worm   395 ERPTLLRRTNMPQQQSFNIPHITTTGPPPPAMGLSVPVQYDQGEYGTQSVRAQL-VALDQRGFRR 458

  Fly   161 VRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIE 225
            | |::.....|.||||..|    |.|.   ::.||||||:   .|...:.:|.|.||:|.|:...
 Worm   459 V-LVEKMMPGPFGFYIATG----VVAG---QRAGIFISRV---SLPSLSPMLTVGDEIIYVDEEY 512

  Fly   226 VAGKTLDQVTDMMVANSSNLIITVKPA 252
            |.|::|:.| ..::|..:::.||:.||
 Worm   513 VKGRSLEYV-QSVIAGKTSVTITLLPA 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724 12/35 (34%)
PDZ_signaling 159..250 CDD:238492 32/90 (36%)
C09G1.4NP_510621.2 PDZ_signaling 457..536 CDD:238492 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14102
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.