DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and si:ch211-13f8.1

DIOPT Version :9

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_021322446.1 Gene:si:ch211-13f8.1 / 101882577 ZFINID:ZDB-GENE-061207-4 Length:1068 Species:Danio rerio


Alignment Length:218 Identity:60/218 - (27%)
Similarity:87/218 - (39%) Gaps:53/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SFKRNEAEQSFDKFASLIEQLHKLTNIQFLILYIDPRDNDLLPINNDDNFGRALKTARPLLRVIV 98
            |.||..:.||... .|.:.||.|.:::|.|   ..|:..                         .
Zfish   895 SLKRTPSLQSLHT-ESPLAQLRKASSVQSL---QSPKRK-------------------------F 930

  Fly    99 QRKDDLNEYSGFGTMKPRNLIGSILMGHTPVKTKAPSISIPHDFRQVSAIIDVDIVPETHRRVRL 163
            :|...|.|.|...::.||:|            .|...|....|.|.....: |...|:....:.|
Zfish   931 ERSTILGELSLPLSLAPRDL------------QKEECIEALEDSRGPQGRL-VQAFPDGTLLIEL 982

  Fly   164 LKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAES--TGLLAVNDEVIEVNGIEV 226
            ::...:||.||.|..|..        ....||::.| |..|:.|:  ||||.|.||::||||..:
Zfish   983 IRPADNKPFGFVISRGKG--------RPDSGIYVER-VGDGVTENSYTGLLGVGDEILEVNGEII 1038

  Fly   227 AGKTLDQVTDMMVANSSNLIITV 249
            ||.||||||.:|..::...|.|:
Zfish  1039 AGLTLDQVTRLMTRDTKATIRTL 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724 12/66 (18%)
PDZ_signaling 159..250 CDD:238492 35/93 (38%)
si:ch211-13f8.1XP_021322446.1 DUF4685 338..452 CDD:318034
PDZ_signaling 979..1050 CDD:238492 32/79 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3606
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14102
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.