DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-6 and pard6ga

DIOPT Version :9

Sequence 1:NP_573238.1 Gene:par-6 / 32752 FlyBaseID:FBgn0026192 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001124131.1 Gene:pard6ga / 100170824 ZFINID:ZDB-GENE-050923-1 Length:397 Species:Danio rerio


Alignment Length:335 Identity:151/335 - (45%)
Similarity:203/335 - (60%) Gaps:52/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NLIEVKSKFDAEFRRWSFKRNEAEQSFDKFASLIEQLHKLTNIQFLILYIDPRDNDLLPINNDDN 82
            :::|||||:.|||||:|..|.|..: :..|..||.:||:|.:....|.|.|.. .:|||||||||
Zfish    15 SMLEVKSKYGAEFRRFSVDRYEPGR-YKDFYRLIVRLHQLWHTDVFIGYADVH-GELLPINNDDN 77

  Fly    83 FGRALKTARPLLRVIVQRKDDLNEYSGFG---TMKPRNLIGSILMGHTPVKTKAPSISIPHDFRQ 144
            |.:|:.:.:.|||:.:|.:::..:.|...   |.:.:::      .|   :..|..||.||:||.
Zfish    78 FCKAVSSTQSLLRIFIQLREEAEQCSACPDDMTKRKKSI------SH---RKPAFQISKPHNFRP 133

  Fly   145 VSAIIDVDIVPETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAEST 209
            ||:|||||:|||:||||||.:..||:||||:|||||:|.||..||||:||:||||:||||||..|
Zfish   134 VSSIIDVDLVPESHRRVRLYRQNSDRPLGFFIRDGTTVTVTPYGLEKRPGVFISRIVPGGLAACT 198

  Fly   210 GLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQRTLTSTHRGSFSRNSQLSSG 274
            ||||:||:|:|||||||:|||||||||||:|||.|||||||||||      |.....::...|:.
Zfish   199 GLLALNDQVLEVNGIEVSGKTLDQVTDMMIANSHNLIITVKPANQ------HNNITRKSCASSTT 257

  Fly   275 SHHTNNTNT----------------SDEIEHDDQDDIVDLTGVTLDESPTSTSAGNHNHQPPLSS 323
            .|:..:|.:                ..|.|.|     |||    :.|.|.     .|.:..|..|
Zfish   258 GHYFESTESVCYPGLPMIMKAYGFNGSESEED-----VDL----VIERPV-----KHQYSSPHVS 308

  Fly   324 SPSSHHQQAA 333
              :|:..|.|
Zfish   309 --TSYRPQVA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-6NP_573238.1 PB1_Par6 20..101 CDD:99724 37/80 (46%)
PDZ_signaling 159..250 CDD:238492 69/90 (77%)
pard6gaNP_001124131.1 PB1_Par6 17..96 CDD:99724 37/80 (46%)
PDZ_signaling 148..239 CDD:238492 69/90 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586327
Domainoid 1 1.000 81 1.000 Domainoid score I8430
eggNOG 1 0.900 - - E1_KOG3606
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I2768
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D356104at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14102
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1143
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.