DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and UBC5

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_010344.1 Gene:UBC5 / 851631 SGDID:S000002466 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:48/143 - (33%)
Similarity:76/143 - (53%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPLTPPKAY 81
            :::.:||.::...||..........|:...||.|.||:.:|||.|:|.:.:....|:|..|||..
Yeast     5 KRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVN 69

  Fly    82 FLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDD 146
            |.|||:|||:.::|.||::.||..|.|.|.:..:||:|..||...||:..|..|..::.......
Yeast    70 FTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAK 134

  Fly   147 YSQRARMMTEIHA 159
            |...|:..|:.:|
Yeast   135 YEATAKEWTKKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 47/141 (33%)
UBCc 16..155 CDD:238117 46/137 (34%)
UBC5NP_010344.1 UBCc 3..147 CDD:412187 47/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.