DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and PEX4

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001031939.1 Gene:PEX4 / 832645 AraportID:AT5G25760 Length:157 Species:Arabidopsis thaliana


Alignment Length:147 Identity:53/147 - (36%)
Similarity:88/147 - (59%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLTK 85
            :|:|..:...|: |:::.:::::....|||.||:.|||..|:|::..::.:.:||.||:..||||
plant    13 KEVQREKVADPD-IQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTK 76

  Fly    86 IFHPNV-AANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDD--- 146
            |||||| ...||||::.||..|.|...::.:...|..|:..|.|:|.||.::|.:|  |..|   
plant    77 IFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLL--RSGDVRG 139

  Fly   147 YSQRARMMTEIHAQPAK 163
            ::..|:|.|.:.|.|.|
plant   140 FNSMAQMYTRLAAMPKK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 50/141 (35%)
UBCc 16..155 CDD:238117 49/137 (36%)
PEX4NP_001031939.1 UQ_con 7..148 CDD:365926 49/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.