DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and Ube2s

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_598538.1 Gene:Ube2s / 77891 MGIID:1925141 Length:223 Species:Mus musculus


Alignment Length:228 Identity:128/228 - (56%)
Similarity:153/228 - (67%) Gaps:31/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLN 70
            ||||||.|..||.|.:|:..:...||:||||..||.|:||:|..|:||.|||||.|:||:||.|.
Mouse     3 SNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLG 67

  Fly    71 KDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEE 135
            ||||.:|||.|||||||||||..|||||||.||:||..:|||:|:|||||||||.||||||||||
Mouse    68 KDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEE 132

  Fly   136 AGKMLLERYDDYSQRARMMTEIH-------------AQPAKCGV----------GAVGDAKDDGG 177
            ||::|||.|::|:.|||::||||             .|....|.          |.:|.|:   |
Mouse   133 AGRLLLENYEEYAARARLLTEIHGGACSTSSGRAEATQDLASGASASSADPMIPGVLGGAE---G 194

  Fly   178 PSTKKHAG-LDKKLQDKKKEKLLKEKKRMLKRL 209
            |..||||| .||||..|||    .:|||.|:||
Mouse   195 PMAKKHAGERDKKLAAKKK----LDKKRALRRL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 97/159 (61%)
UBCc 16..155 CDD:238117 92/138 (67%)
Ube2sNP_598538.1 UQ_con 16..152 CDD:306648 90/135 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..223 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850365
Domainoid 1 1.000 200 1.000 Domainoid score I3028
eggNOG 1 0.900 - - E2759_KOG0423
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56676
Inparanoid 1 1.050 240 1.000 Inparanoid score I3332
Isobase 1 0.950 - 0 Normalized mean entropy S899
OMA 1 1.010 - - QHG53499
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007037
OrthoInspector 1 1.000 - - otm43029
orthoMCL 1 0.900 - - OOG6_103684
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4812
SonicParanoid 1 1.000 - - X5130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.