DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and ube2s

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001020707.1 Gene:ube2s / 565498 ZFINID:ZDB-GENE-050913-92 Length:221 Species:Danio rerio


Alignment Length:229 Identity:117/229 - (51%)
Similarity:146/229 - (63%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLN 70
            ||||||.||.:|.|.:|:..:...||||||:..:|.|:|::...|:||.|||||.|:||::|.|.
Zfish     3 SNVENLPPQVLRLVYKEVSALAADPPEGIKIYPSEEDITELHTSIEGPEGTPYAGGVFRMRLVLG 67

  Fly    71 KDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEE 135
            ||||..||:.|||||||||||...||||||.||:|||.:||::|:|||||||||.||||||||||
Zfish    68 KDFPAVPPRGYFLTKIFHPNVGHKGEICVNVLKRDWKAELGLRHVLLTIKCLLIHPNPESALNEE 132

  Fly   136 AGKMLLERYDDYSQRARMMTEIHAQPAKCGVGAVGDAKDD--GGPSTKKHAGLDKK--------- 189
            |||:|||.|.:|:.||.::|||||      :|....|..:  .||..|||||...|         
Zfish   133 AGKLLLEDYKEYASRAHLLTEIHA------MGGTSGAPQEPADGPQPKKHAGDPNKRVVGAGLPT 191

  Fly   190 --------------LQDKKKEKLLKEKKRMLKRL 209
                          :..|||    .:|||.|:||
Zfish   192 MGTGTNNSNISNTNIVAKKK----TDKKRALRRL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 90/146 (62%)
UBCc 16..155 CDD:238117 85/138 (62%)
ube2sNP_001020707.1 COG5078 10..157 CDD:227410 92/152 (61%)
UBCc 14..152 CDD:238117 85/137 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..221 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596285
Domainoid 1 1.000 190 1.000 Domainoid score I3206
eggNOG 1 0.900 - - E2759_KOG0423
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56676
Inparanoid 1 1.050 227 1.000 Inparanoid score I3460
OMA 1 1.010 - - QHG53499
OrthoDB 1 1.010 - - D1412570at2759
OrthoFinder 1 1.000 - - FOG0007037
OrthoInspector 1 1.000 - - oto38828
orthoMCL 1 0.900 - - OOG6_103684
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4812
SonicParanoid 1 1.000 - - X5130
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.