DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and ube2d3

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001016064.1 Gene:ube2d3 / 548818 XenbaseID:XB-GENE-972278 Length:147 Species:Xenopus tropicalis


Alignment Length:144 Identity:49/144 - (34%)
Similarity:79/144 - (54%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPLTPPKA 80
            ::::.:||.::...||..........|:...||.|.||..:||..|:|.:.:....|:|..|||.
 Frog     3 LKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKV 67

  Fly    81 YFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYD 145
            .|.|:|:|||:.:||.||::.|:..|.|.|.|..:||:|..||..|||:..|..|..::.....:
 Frog    68 AFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRE 132

  Fly   146 DYSQRARMMTEIHA 159
            .|::.||..|:.:|
 Frog   133 KYNRIAREWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 48/142 (34%)
UBCc 16..155 CDD:238117 47/138 (34%)
ube2d3NP_001016064.1 UBCc 1..146 CDD:412187 48/142 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.