DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and ube2ka

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001013500.1 Gene:ube2ka / 541355 ZFINID:ZDB-GENE-050320-48 Length:200 Species:Danio rerio


Alignment Length:151 Identity:43/151 - (28%)
Similarity:86/151 - (56%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFP 74
            |::.|.|::..:|:.:.|.|....|||.:.:.:.|:::..|.||..|||..|.:::::.:.:.:|
Zfish     3 NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYP 67

  Fly    75 LTPPKAYFLTKIFHPNVAA-NGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGK 138
            ..|||..|:|||:|||::: .|.||::.||..|...:.::.:||:::.||....|:...:.....
Zfish    68 FNPPKVRFITKIWHPNISSVTGAICLDILKGQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAN 132

  Fly   139 MLLERYDDYSQRARMMTEIHA 159
            ...:..:.:.|.||:.:.:.|
Zfish   133 QYKQNPEMFKQTARLWSHVCA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 41/147 (28%)
UBCc 16..155 CDD:238117 40/139 (29%)
ube2kaNP_001013500.1 COG5078 1..148 CDD:227410 42/144 (29%)
UBCc 6..148 CDD:238117 41/141 (29%)
UBA_like_SF 163..200 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.