DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and CG46338

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:154 Identity:36/154 - (23%)
Similarity:68/154 - (44%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TIRQ---VMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFP-- 74
            ||:|   ::.|.:.:|:....||.|:.:.::......:..|..|. ||..:||..:.|...||  
  Fly    18 TIQQEYKILAEYKMIESEKLSGIYVIPSYANSLQWFGVFFGRQGL-YAESVFRFTILLPDRFPDD 81

  Fly    75 LTPPKAYFLTKIFHPNVAA-NGEICVNTLKKDWKPDLGIKHILLTIKCL-LIVPNPESAL----- 132
            .:.|...|...:.||:|.. ...:.|:....:|:  .|..|:...:|.| :|..:|..::     
  Fly    82 KSLPSIIFQQDVIHPHVCPYTHSLDVSHAFPEWR--CGEDHLWQLLKYLQVIFSDPLDSIRGIEV 144

  Fly   133 ----NEEAGKMLLERYDDYSQRAR 152
                |.||.::|:...::|..|.:
  Fly   145 DKLKNSEAAELLMNNKEEYVARVQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 36/154 (23%)
UBCc 16..155 CDD:238117 35/153 (23%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 35/153 (23%)
COG5078 24..176 CDD:227410 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.