DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and CG14739

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:197 Identity:53/197 - (26%)
Similarity:96/197 - (48%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKD 72
            |....|...|::.|::..:..:   |.:..::: |:|::...::||.|:.|..||:.|.:|:.:|
  Fly     7 VNTTLPMAGRRLDRDVNRLLAS---GYRTTVDD-DMTNLNVCLEGPLGSAYEGGIWTVNVTMPQD 67

  Fly    73 FPLTPPKAYFLTKIFHPNVA-ANGEICVNTLKKDWKPDLGIKHILLT-IKCLLIVPNPESALNEE 135
            :|||.|:..|:|||.|||:. ..|.:|:|.||:.|.....:.:|..| :..||..|||..:||..
  Fly    68 YPLTAPRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHR 132

  Fly   136 AGKMLLERYDDYSQRARMMTEIHAQPAKCGVGAVGDAKDDGGPSTK-KHAGLDKKLQDKKKEKLL 199
            |..::......:.:...:..:.:|.||..             |:.: ...||:|:..|.....||
  Fly   133 AAAIMKHSEQLFREHVILCMKTYAMPANL-------------PTRQLVEEGLEKRSSDLSLSDLL 184

  Fly   200 KE 201
            .:
  Fly   185 TD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 42/148 (28%)
UBCc 16..155 CDD:238117 41/140 (29%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 42/148 (28%)
UQ_con 17..152 CDD:278603 40/138 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.