DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and Ubc6

DIOPT Version :10

Sequence 1:NP_573237.2 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:82/146 - (56%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPL 75
            :|....|::||:.:.::..||.|:.....::::....|:|.||..||:..|.|::.:...:::|.
  Fly     1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65

  Fly    76 TPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKML 140
            .||...|::|:|||||.|:|.||::.|:..|.|...:..||.:|:.||..|||.|..|..|.::.
  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLY 130

  Fly   141 LERYDDYSQRARMMTE 156
            .|...:|.:|.:...|
  Fly   131 KENRREYEKRVKACVE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_573237.2 UBCc_UBE2S 13..158 CDD:467424 46/144 (32%)
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 45/141 (32%)

Return to query results.
Submit another query.