DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and CG7656

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:211 Identity:59/211 - (27%)
Similarity:97/211 - (45%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPQTIRQVMRELQEMETTPPEGIKV-LINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPL 75
            |...:|.:..|.:.::..|.||.:| |||:.::.:.:..|.||..|.|..|.|:..:....|:|.
  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102

  Fly    76 TPPKAYFLTKIFHPNVAANGEICVNTLK-------------KDWKPDLGIKHILLTIKCLLIVPN 127
            :||...||||::||||..||::|::.|.             :.|.|...::.|||::..||..||
  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167

  Fly   128 PESALNEEAGKMLLERYDDYSQRARMMTEIHAQPAKCGVGAVGDAKDDG---------------- 176
            ..|..|.:| .::..|:.|...:......|..:.|   :.|..:||.:|                
  Fly   168 TFSPANVDA-SVMYRRWRDSQGKDNEYPNIIRKQA---LAANAEAKREGIVVPMTLEDYCLKPTR 228

  Fly   177 GPSTKKHAGLDKKLQD 192
            .|:|:  :|||....|
  Fly   229 KPTTE--SGLDANFYD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 48/160 (30%)
UBCc 16..155 CDD:238117 46/152 (30%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 45/144 (31%)
COG5078 45..182 CDD:227410 43/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.