DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and Ubc4

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:184 Identity:51/184 - (27%)
Similarity:93/184 - (50%) Gaps:21/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLSPQTIRQVMRELQEMETTPPEGIKV-LINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDF 73
            |::...|::..:|:...|......||: |:|:| .|:::..|.||..|||..|.|.:::.:.:.:
  Fly     3 NMAVSRIKREFKEVMRSEEIVQCSIKIELVNDS-WTELRGEIAGPPDTPYEGGKFVLEIKVPETY 66

  Fly    74 PLTPPKAYFLTKIFHPNVAA-NGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAG 137
            |..|||..|:|:|:|||::: .|.||::.||.:|...:.::.:||:::.||....|:...:....
  Fly    67 PFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVA 131

  Fly   138 KMLLERYDDYSQRARMMTEIHAQPAKCGVGAVGDAKDDGGPSTKKHAGLDKKLQ 191
            ....::||.:...|:..|..:|                |||.|  ....|.|:|
  Fly   132 YQFKDKYDLFLLTAKHWTNAYA----------------GGPHT--FPDCDSKIQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 42/148 (28%)
UBCc 16..155 CDD:238117 41/140 (29%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 43/150 (29%)
UQ_con 8..149 CDD:278603 41/141 (29%)
UBA_II_E2_UBCD4 163..198 CDD:270574 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.